- TTLL9 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-92543
- Rabbit
- C20orf125
- 0.1 ml (also 25ul)
- Human
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Immunohistochemistry, Immunohistochemistry-Paraffin
- tubulin tyrosine ligase like 9
- Polyclonal
- Immunogen affinity purified
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- Primary Antibodies
- IgG
- Novus Biologicals, a Bio-Techne Brand
- This antibody was developed against Recombinant Protein corresponding to amino acids: GITWIMKPVA RSQGKGIFLF RRLKDIVDWR KDTRSSDDQK DDIPVENYVA QRYIE
- TTLL9
Specifications/Features
Available conjugates: Unconjugated
Sequence
GITWIMKPVARSQGKGIFLFRRLKDIVDWRKDTRSSDDQKDDIPVENYVAQRYIE